PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C019923P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 554aa    MW: 61221.7 Da    PI: 5.6181
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C019923P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.48e-193885148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ede+l+++vk++G g+W+++ ++ g+ R++k+c++rw ++l
   MELO3C019923P1 38 KGPWTSAEDEILIEYVKKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 85
                     79******************************************9986 PP

2Myb_DNA-binding52.11.5e-1691134146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ l++++++++G++ W++ a++++ gRt++++k++w++
   MELO3C019923P1  91 KGAFTAEEEHLIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 134
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.9843385IPR017930Myb domain
SMARTSM007179.2E-173787IPR001005SANT/Myb domain
SuperFamilySSF466893.67E-3137132IPR009057Homeodomain-like
PfamPF002491.0E-163885IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-253993IPR009057Homeodomain-like
CDDcd001678.84E-134085No hitNo description
PROSITE profilePS5129426.0686140IPR017930Myb domain
SMARTSM007171.1E-1590138IPR001005SANT/Myb domain
PfamPF002491.4E-1591134IPR001005SANT/Myb domain
CDDcd001672.64E-1193134No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2594139IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MRHPKNEIED NLPSQDQTLS PLLDEDSGGN ASGIVLKKGP WTSAEDEILI EYVKKHGEGN  60
WNAVQKHSGL SRCGKSCRLR WANHLRPNLK KGAFTAEEEH LIIELHAKMG NKWARMAAHL  120
PGRTDNEIKN YWNTRIKRRQ RAGLPLYPPE VCLRTWQALQ QTQDSGGSTI VDNDHHDLLR  180
ANSYDIPDVT FHSLKPQSAL SYMPELPDIS SCMLKRGLDS SQYCNFMQSA LHRQKRFRDS  240
ASLFPGPDGS VKTPFHQFED NSYSQAAQSF GTPFAVESNP TTKNAMSFGS FEGSHSLTNG  300
NSSASQHSKE TEKLELPSLQ YPETDLTSWD TTIQPAMFES VDPFIQSTPT FVLQATDRQS  360
PCHSGLLEAL VYPKPMGPKN HPSDKNSNSC SVTPGDVTDS YNMAASKTEI DDYTEVISPF  420
GHSTSSLFSE CTPISATGSS YEDPTLTEAF SGSHVKSEPL DHAWTPDREK AAKSRVNFAR  480
PDALLTSDWH DRSSGIVEDT TNVTDAISLL LGDDLAADYE HFPNGISTTH SAWGLDSCSW  540
NNMPAVCHMS DLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-32361395107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818210.0LN681821.1 Cucumis melo genomic scaffold, anchoredscaffold00040.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008456638.10.0PREDICTED: transcription factor GAMYB
RefseqXP_008456639.10.0PREDICTED: transcription factor GAMYB
TrEMBLA0A0A0KB600.0A0A0A0KB60_CUCSA; Uncharacterized protein
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-120myb domain protein 33